Protein coding transcript 226895

• Transcript: Ll_transcript_99298
• CDS coordinates: 1238-1867 (+)
• Peptide sequence: MLLFNFLFALALQYLNPFDKPQALISEETLAERNAVRKDHIIELSSTYKGSSDKGNESRRNVSSRTLSARVGSFSAVHHNKKQGMVLPFTPLSITFDEIRYAVDMPQEMKAQGFPDDQLELLKGVNGAFRPGVLTALMSVSGAGKTTLMDAQSGRKTTGYVQGKITISGYQDIVSKLTSTLPMLQSMSHLFILHGLGYLLRLIPQPDRY*
• ORF Type: complete

Annotations of Ll_transcript_99298

• Blastp: ABC transporter G family member 53 from Oryza sativa with 54.12% of identity
• Blastx: Pleiotropic drug resistance protein 1 from Nicotiana with 66.32% of identity
• Eggnog: (ABC) transporter(COG0842)
• Kegg: Link to kegg annotations (9269190)
• CantataDB: Link to cantataDB annotations (CNT0002116)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437695.1)
• Pfam: Plant PDR ABC transporter associated (PF08370.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;