Protein coding transcript 226897

• Transcript: Ll_transcript_99300
• CDS coordinates: 365-691 (+)
• Peptide sequence: MLLFNFLFALALQYLNPFDKPQALISEETLAERNAVRKDHIIELSSTYKGSSDKGNESRRNVSSRTLSARVGSFSAVHHNKKQGMVLPFTPLSITFDEIRYAVDMPQV*
• ORF Type: complete

Annotations of Ll_transcript_99300

• Blastp: ABC transporter G family member 39 from Oryza sativa with 42.99% of identity
• Blastx: ABC transporter G family member 39 from Oryza sativa with 46.32% of identity
• Eggnog: (ABC) transporter(COG0842)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437695.1)
• Pfam: Plant PDR ABC transporter associated (PF08370.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;