Protein coding transcript 226913

• Transcript: Ll_transcript_99988
• CDS coordinates: 60-512 (+)
• Peptide sequence: MEGTCFAKTVFGGQPSKPDYGYVPYAVFSIPPLSVVGFSEEEAIEHTNGDLLVFTSTFNPMKNTISGRQEKTVMKLLVDAETDKVLGASMCGPDAPEIMQGIAVALKCGATKAQFDSTVGLHPSAAEEFVTMRSETRRIAASTKKAQKNL*
• ORF Type: complete

Annotations of Ll_transcript_99988

• Blastp: Glutathione reductase, cytosolic from Pisum with 81.25% of identity
• Blastx: Glutathione reductase, cytosolic from Pisum with 82.82% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461512.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain (PF02852.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;