Protein coding transcript 226984

• Transcript: Ll_transcript_98144
• CDS coordinates: 287-583 (+)
• Peptide sequence: MARKMLIDGEVETKFDFDLFVIGAGSGGVRASRFSANFGAKVGICELPFHPVSSETIGGVGGTCVIRGCVPKKILVYGASFGGELEDSRNYGWDLNEKL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_98144

• Blastp: Glutathione reductase, cytosolic from Arabidopsis with 76.85% of identity
• Blastx: Glutathione reductase, cytosolic from Arabidopsis with 76.85% of identity
• Eggnog: dihydrolipoyl dehydrogenase(COG1249)
• Kegg: Link to kegg annotations (AT3G24170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461512.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase (PF07992.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;