Protein coding transcript 226992

• Transcript: Ll_transcript_98149
• CDS coordinates: 93-464 (+)
• Peptide sequence: MKCFAFYYRGKKNDRKILQSMSGQSEMNSQNISDTSSDSLRRNAFPSFSQRPSNLKVFTVLELKSATKNFSRSVMLGEGGFGCVYKGLINSVDDPSRKIEVAVKQLGKSGTQARVRLLFSLVKV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_98149

• Blastp: Probable serine/threonine-protein kinase PBL18 from Arabidopsis with 40% of identity
• Blastx: Probable serine/threonine-protein kinase PBL2 from Arabidopsis with 52.17% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G69790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460816.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;