Protein coding transcript 227

• Transcript: Ll_transcript_352614
• CDS coordinates: 1-363 (+)
• Peptide sequence: QVREEINKIDKDYIRKLKDGEEHLEFLKNSSNRVLVKRELISFQFTSLCKFPLYDADFGFGKPTWVGSPALTFKNLVVFVDTKNDGGIEAYVHLMLEDMAKFEEDKELVECVEQNYMNCN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_352614

• Blastp: BAHD acyltransferase BIA1 from Arabidopsis with 32.73% of identity
• Blastx: BAHD acyltransferase BIA1 from Arabidopsis with 31.82% of identity
• Eggnog: transferase Family(ENOG411040F)
• Kegg: Link to kegg annotations (AT4G15400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438324.1)
• Pfam: Transferase family (PF02458.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;