Transcript | Ll_transcript_352614 |
---|---|
CDS coordinates | 1-363 (+) |
Peptide sequence | QVREEINKIDKDYIRKLKDGEEHLEFLKNSSNRVLVKRELISFQFTSLCKFPLYDADFGFGKPTWVGSPALTFKNLVVFVDTKNDGGIEAYVHLMLEDMAKFEEDKELVECVEQNYMNCN* |
ORF Type | 5prime_partial |
Blastp | BAHD acyltransferase BIA1 from Arabidopsis with 32.73% of identity |
---|---|
Blastx | BAHD acyltransferase BIA1 from Arabidopsis with 31.82% of identity |
Eggnog | transferase Family(ENOG411040F) |
Kegg | Link to kegg annotations (AT4G15400) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438324.1) |
Pfam | Transferase family (PF02458.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer