Protein coding transcript 22704

• Transcript: Ll_transcript_366138
• CDS coordinates: 293-994 (+)
• Peptide sequence: MQVSYSSMNSWLKTRVPLEPCSTTSTTLFTPISYSTCINVLHSPQYKNNNCVSFLVSQRKGFTTLTPVSPMKKMSRKRRFFTVSALFERFTERAIKAIMFSQREAKSLGSDLVYTQHLLLGLISEEDRSLDGFLSSGVTIDKARDAVRSIWHQNDNSTSGDGDGDDDGRRSYVSASHIPFSISSKRVFEAAVEYSKSLGHKFIAPEHILVALVKVDDGSATRVLYRYYLNCSL*
• ORF Type: complete

Annotations of Ll_transcript_366138

• Blastp: Chaperone protein ClpD, chloroplastic from Arabidopsis with 58.38% of identity
• Blastx: Chaperone protein ClpD, chloroplastic from Arabidopsis with 57.8% of identity
• Eggnog: ATP-dependent CLP protease ATP-binding subunit(COG0542)
• Kegg: Link to kegg annotations (AT5G51070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429737.1)
• Pfam: Clp amino terminal domain, pathogenicity island component (PF02861.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;