Protein coding transcript 227076

• Transcript: Ll_transcript_99961
• CDS coordinates: 61-780 (+)
• Peptide sequence: MATTQLSKKRKFVADGVFFAELNEVLTRELAEDGYSGVEVRVTPMRTEIIIRATRTQAVLGEKGRRIRELTSVVQKRFKFQENTVELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGATGCGVIVSGKLRAQRAKSMKFKDGYMISSGQPVKDYIDSAVRHVLLRQGVLGIKVKIMLDWDPKGKQGPKTPLPDIVTIHTPKEEEEYIRPPPAVIANEIEVPVAVA*
• ORF Type: complete

Annotations of Ll_transcript_99961

• Blastp: 40S ribosomal protein S3-3 from Arabidopsis with 89.09% of identity
• Blastx: 40S ribosomal protein S3-3 from Arabidopsis with 89.09% of identity
• Eggnog: Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation (By similarity)(COG0092)
• Kegg: Link to kegg annotations (AT5G35530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433727.1)
• Pfam: KH domain (PF07650.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;