Transcript | Ll_transcript_98442 |
---|---|
CDS coordinates | 398-1123 (+) |
Peptide sequence | MDAQHQHEVKEPNNALVMNKKIRSIIAERQAVILELELEAAISEKNEALAARDLALRQRDEALAQRDNALMERDIALAALQNRNNTVNLSLGGVQCGSKRTHQAAYSTKDMPIRDAAPVTVITAEAVKSRQAKRSKENKVSNSKASKSPTKLGEDLNRHASSQGTKIKSEWDKLDVGLNLVAFDETTMPAPVCTCTGVPRQCYKWGSGGWQSSCCTNTLSMYPLPQLPNKRHTRIGGRKMSG |
ORF Type | 3prime_partial |
Blastp | Protein BASIC PENTACYSTEINE4 from Arabidopsis with 55.04% of identity |
---|---|
Blastx | Protein BASIC PENTACYSTEINE4 from Arabidopsis with 55.1% of identity |
Eggnog | Transcriptional activator(ENOG41116WE) |
Kegg | Link to kegg annotations (AT2G21240) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462511.1) |
Pfam | GAGA binding protein-like family (PF06217.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer