Protein coding transcript 22716

• Transcript: Ll_transcript_364863
• CDS coordinates: 1-357 (+)
• Peptide sequence: ILGRFLSNRDNNIRYVALNMLMKAVTVDAQAVQRHRATILECVKDSDASIQKRALELVYVLVNETNVKPLAKELIDYLKVSDHDFRGDLTAKICSIVAKFSPEKIWYIDQMLKVLSEV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_364863

• Blastp: AP-1 complex subunit gamma-2 from Arabidopsis with 87.18% of identity
• Blastx: AP-1 complex subunit gamma-2 from Arabidopsis with 85.95% of identity
• Eggnog: Adaptor-related protein complex(ENOG410XPKK)
• Kegg: Link to kegg annotations (AT1G60070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421654.1)
• Pfam: Adaptin N terminal region (PF01602.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;