Protein coding transcript 227239

• Transcript: Ll_transcript_99608
• CDS coordinates: 58-597 (+)
• Peptide sequence: MAASSVSCLLLLFLISGLSAASKEILVGGKVDAWKIPSSSSDFLNQWAQRSRFQVGDHLVWKYEGGKDSVLRVGREDYANCSTSNPIKVYNDGNTKVKLDHPGPFYFISGAKGHCEKGQKLIVVVMTPRGTNTGISNAPSPAPSQNLEGGPAPSPTSTATPLKTCGLLILAVFVAMWVF*
• ORF Type: complete

Annotations of Ll_transcript_99608

• Blastp: Early nodulin-like protein 1 from Arabidopsis with 53.61% of identity
• Blastx: Early nodulin-like protein 1 from Arabidopsis with 59.35% of identity
• Eggnog: Early nodulin-like protein(ENOG410YW92)
• Kegg: Link to kegg annotations (AT2G25060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447587.1)
• Pfam: Plastocyanin-like domain (PF02298.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;