Protein coding transcript 227241

• Transcript: Ll_transcript_99613
• CDS coordinates: 515-820 (+)
• Peptide sequence: MSSLDFILMEPAEAVGVGGGKWTDQETLLLFEALELYKENWNEIAEHVGIKPKPQCILHFIQMPIAIPLLILMMMMFIKPQNNSGSQLVTILFGNMRVVRI*
• ORF Type: complete

Annotations of Ll_transcript_99613

• Blastp: SWI/SNF complex subunit SWI3D from Arabidopsis with 81.36% of identity
• Blastx: Early nodulin-like protein 1 from Arabidopsis with 60.67% of identity
• Eggnog: SWI SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member(COG5259)
• Kegg: Link to kegg annotations (AT4G34430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447587.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;