Protein coding transcript 227242

• Transcript: Ll_transcript_99623
• CDS coordinates: 2-505 (+)
• Peptide sequence: KAALKMVEEVRRQFNTIPGLMEGTTKPDYATCVKISTDASIKEMIPPGALVMLTPLIVGILFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHARSLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_99623

• Blastp: Pyrophosphate-energized vacuolar membrane proton pump from Vigna with 97.6% of identity
• Blastx: Pyrophosphate-energized vacuolar membrane proton pump from Vigna with 97.6% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463402.1)
• Pfam: Inorganic H+ pyrophosphatase (PF03030.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;