Transcript | Ll_transcript_99799 |
---|---|
CDS coordinates | 1086-1760 (+) |
Peptide sequence | MSSIKNKELNSYDGVVAVGGDGFFNEILNGFLSPRLKAPNPPTPPDFVHLVKDNGDSLVLDEKESVEETSNNSENQFPLISTLEQSGSRISYSCSEDMDPEFPVPNERFRFGIIPSGSTDAIVMCTTGVRDPITSALQIVLGKRVQLDIAQVVRWKTTPTSAVEPYVRYAASFSGYGFYGDVITESEKYRWMGPKRYDYAGTMVFLRHRYSIISALNVISRFPD* |
ORF Type | complete |
Blastp | Ceramide kinase from Arabidopsis with 60.85% of identity |
---|---|
Blastx | Ceramide kinase from Arabidopsis with 62% of identity |
Eggnog | diacylglycerol kinase(COG1597) |
Kegg | Link to kegg annotations (AT5G51290) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431038.1) |
Pfam | Diacylglycerol kinase catalytic domain (PF00781.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer