Protein coding transcript 227284

• Transcript: Ll_transcript_99799
• CDS coordinates: 1086-1760 (+)
• Peptide sequence: MSSIKNKELNSYDGVVAVGGDGFFNEILNGFLSPRLKAPNPPTPPDFVHLVKDNGDSLVLDEKESVEETSNNSENQFPLISTLEQSGSRISYSCSEDMDPEFPVPNERFRFGIIPSGSTDAIVMCTTGVRDPITSALQIVLGKRVQLDIAQVVRWKTTPTSAVEPYVRYAASFSGYGFYGDVITESEKYRWMGPKRYDYAGTMVFLRHRYSIISALNVISRFPD*
• ORF Type: complete

Annotations of Ll_transcript_99799

• Blastp: Ceramide kinase from Arabidopsis with 60.85% of identity
• Blastx: Ceramide kinase from Arabidopsis with 62% of identity
• Eggnog: diacylglycerol kinase(COG1597)
• Kegg: Link to kegg annotations (AT5G51290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431038.1)
• Pfam: Diacylglycerol kinase catalytic domain (PF00781.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;