Protein coding transcript 227293

• Transcript: Ll_transcript_99786
• CDS coordinates: 972-2081 (+)
• Peptide sequence: MSSITNKELNSYDGVVAVGGDGFFNEILNGFLSPRLKAPNPPTPPDFVHLVKDNSDSLVPDENETIAETSNDSEDQFPLVSTLEQSGSRISYSCSEDTDPEFPVPNERFRFGIIPAGSTDAIVICTTGARDPVTSALQVVLGKRVHLDIAQVVRWKTTPMSEVEPYVRYAASFSGYGFYGDVITESEKYRWMGPKRYDYAGTMVFLRHRSYEAEIAYLDVQSDETNLTSKRNRQGSLLRSLGAPHKPERYICRVNCIVCNERPDLATAGVSGLTPHLYSEKIRWVKSKGRFLSVGAAVISCRNEKAPDGLVADAHLSDGFLHLILIRDCPHASYLWHLTQLTRRGGSPLNFKFVEHHKTPAFTFTSSGTE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_99786

• Blastp: Ceramide kinase from Arabidopsis with 57.37% of identity
• Blastx: Ceramide kinase from Arabidopsis with 55.57% of identity
• Eggnog: diacylglycerol kinase(COG1597)
• Kegg: Link to kegg annotations (AT5G51290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440892.1)
• Pfam: Diacylglycerol kinase catalytic domain (PF00781.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;