Protein coding transcript 227342

• Transcript: Ll_transcript_99337
• CDS coordinates: 889-1365 (+)
• Peptide sequence: MESLNVVPTSKSQALQRSGRAGREGPGKCFRLYPENEFGKLEDSTKPEIKRCNLSNVILQLKALGVDDILGFDFIEKPSRAAIIKSLEQLFLLGALTDECRLSDPVGYQMARLPLDPVYSKALILASQFNCLEEMLITVAMLSAESIFYAPRDKLDEV*
• ORF Type: complete

Annotations of Ll_transcript_99337

• Blastp: Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 from Arabidopsis with 79.62% of identity
• Blastx: Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 from Arabidopsis with 77% of identity
• Eggnog: helicase(COG1643)
• Kegg: Link to kegg annotations (AT1G26370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434270.1)
• Pfam: Helicase associated domain (HA2) (PF04408.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;