Protein coding transcript 227351

• Transcript: Ll_transcript_100677
• CDS coordinates: 1025-1621 (+)
• Peptide sequence: MLYLSTEFPGLKNVRIFTYKELRNACDNFSSANKIGEGGFGSVYKGLLKDGKVAAIKVLSAESRQGVREFLTEINVISEIEHENLVKLYGCCVEGDQRILVYNYLENNSLAQTLLGGGYSDIQFNWRTRSRICIGVARGLAFLHEEVRPHIVHRDIKASNILLDEDLIPKISDFGLAKLIPSHLTHVSTRVAGTMYAF*
• ORF Type: complete

Annotations of Ll_transcript_100677

• Blastp: Cold-responsive protein kinase 1 from Arabidopsis with 76.44% of identity
• Blastx: Cold-responsive protein kinase 1 from Arabidopsis with 76.44% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G16670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465059.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;