| Transcript | Ll_transcript_100678 |
|---|---|
| CDS coordinates | 2000-2350 (+) |
| Peptide sequence | MVDISLNGFFDAEEACRILKIALLCTQDNPKLRPSMSSVVKMLSGEIDVGESKITKPSMISDIMDLKVKEQKGNDDMKISSSRSASSASDSQGNTLSFAASSAANTTFTVQYDQST* |
| ORF Type | complete |
| Blastp | Cold-responsive protein kinase 1 from Arabidopsis with 52.59% of identity |
|---|---|
| Blastx | Cold-responsive protein kinase 1 from Arabidopsis with 72.52% of identity |
| Eggnog | Serine Threonine protein kinase(COG0515) |
| Kegg | Link to kegg annotations (AT1G16670) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020207871.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer