Transcript | Ll_transcript_100678 |
---|---|
CDS coordinates | 2000-2350 (+) |
Peptide sequence | MVDISLNGFFDAEEACRILKIALLCTQDNPKLRPSMSSVVKMLSGEIDVGESKITKPSMISDIMDLKVKEQKGNDDMKISSSRSASSASDSQGNTLSFAASSAANTTFTVQYDQST* |
ORF Type | complete |
Blastp | Cold-responsive protein kinase 1 from Arabidopsis with 52.59% of identity |
---|---|
Blastx | Cold-responsive protein kinase 1 from Arabidopsis with 72.52% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT1G16670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020207871.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer