Protein coding transcript 227413

• Transcript: Ll_transcript_98204
• CDS coordinates: 112-648 (+)
• Peptide sequence: MQQHDICNPNVKEPRLVATKFLARPQHEGVGAVVRRSIGRFDLNYFDPFLVLDEFSVTAPAGFPDHPHRGFETVTYMLQGAISHEDFEGHKGRIEGGDIQWMTAGRGIVHSEMPASQGTQKGLQLWINLASQHKMVEPRYQEMLSKDIGEGIKDGIKVRVIAGASRETGSQDKSSTVRQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_98204

• Blastp: Pirin-like protein from Lycopersicon with 70.89% of identity
• Blastx: Pirin-like protein from Lycopersicon with 70.89% of identity
• Eggnog: pirin domain protein(COG1741)
• Kegg: Link to kegg annotations (543607)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460983.1)
• Pfam: Pirin (PF02678.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;