Protein coding transcript 227415

• Transcript: Ll_transcript_98206
• CDS coordinates: 112-999 (+)
• Peptide sequence: MQQHDICNPNVKEPRLVATKFLARPQHEGVGAVVRRSIGRFDLNYFDPFLVLDEFSVTAPAGFPDHPHRGFETVTYMLQGAISHEDFEGHKGRIEGGDIQWMTAGRGIVHSEMPASQGTQKGLQLWINLASQHKMVEPRYQEMLSKDIGEGIKDGIKVRVIAGEALGVKSPIYTRTPTMYLDFSLKPGTHLQQPIPKSWNAFVYVLEGEGVFGNPKSHPTNSHHILLLGSGDGLEAWNKSSKQLRFILVGGEPLGEPVVQFGPFVMNTQEEIDQTIDDFDNYANGFEKARHWNSE*
• ORF Type: complete

Annotations of Ll_transcript_98206

• Blastp: Pirin-like protein from Lycopersicon with 66.67% of identity
• Blastx: Pirin-like protein from Lycopersicon with 66.67% of identity
• Eggnog: pirin domain protein(COG1741)
• Kegg: Link to kegg annotations (543607)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460983.1)
• Pfam: Pirin (PF02678.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;