Transcript | Ll_transcript_98206 |
---|---|
CDS coordinates | 112-999 (+) |
Peptide sequence | MQQHDICNPNVKEPRLVATKFLARPQHEGVGAVVRRSIGRFDLNYFDPFLVLDEFSVTAPAGFPDHPHRGFETVTYMLQGAISHEDFEGHKGRIEGGDIQWMTAGRGIVHSEMPASQGTQKGLQLWINLASQHKMVEPRYQEMLSKDIGEGIKDGIKVRVIAGEALGVKSPIYTRTPTMYLDFSLKPGTHLQQPIPKSWNAFVYVLEGEGVFGNPKSHPTNSHHILLLGSGDGLEAWNKSSKQLRFILVGGEPLGEPVVQFGPFVMNTQEEIDQTIDDFDNYANGFEKARHWNSE* |
ORF Type | complete |
Blastp | Pirin-like protein from Lycopersicon with 66.67% of identity |
---|---|
Blastx | Pirin-like protein from Lycopersicon with 66.67% of identity |
Eggnog | pirin domain protein(COG1741) |
Kegg | Link to kegg annotations (543607) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460983.1) |
Pfam | Pirin (PF02678.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer