Protein coding transcript 227432

• Transcript: Ll_transcript_100457
• CDS coordinates: 33-461 (+)
• Peptide sequence: MELEAPQVTKWEGYVNWRNKPALRTHHGGMLAASFVLVVEVLENLAFLANSSNLVLYLRQYMHMSPSKSANNVTNFMGTAFLLALLGGFLSDALFTTYHIYLISALIEFMVSTVPQHSFYLSLHVNIITCLCVKAFISKIVI*
• ORF Type: complete

Annotations of Ll_transcript_100457

• Blastp: Protein NRT1/ PTR FAMILY 4.7 from Arabidopsis with 71.79% of identity
• Blastx: Protein NRT1/ PTR FAMILY 4.6 from Arabidopsis with 76.36% of identity
• Eggnog: transporter(COG3104)
• Kegg: Link to kegg annotations (AT5G62730)
• CantataDB: Link to cantataDB annotations (CNT0001569)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456595.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;