Protein coding transcript 227461

• Transcript: Ll_transcript_99159
• CDS coordinates: 87-1085 (+)
• Peptide sequence: MPPQKIEIFKSLEDWADENILVHLKPVEKCWQPQDFLPDASADGFEEQVKELRERAKELPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRDETGASLTSWAVWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLGFIYTSFQERATFISHGNTARFAKEHGDIKLAQICGLIAADEKRHETAYTKIVEKLFEIDPDGTVVAFADMMRKKISMPAHLMYDGQDDNLFDNYSAVAQRIGVYTAKDYADILEFLVGRWKVEKLTGLSGEGRKAQEYVCGLAPRIRRLEERAQGRLKELPKLKFSWIHDREVQL*
• ORF Type: complete

Annotations of Ll_transcript_99159

• Blastp: Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic from Soja with 93.01% of identity
• Blastx: Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic from Soja with 92.16% of identity
• Eggnog: Converts stearoyl-ACP to oleoyl-ACP by introduction of a cis double bond between carbons Delta(9) and Delta(10) of the acyl chain(ENOG410XPNS)
• Kegg: Link to kegg annotations (547808)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445741.1)
• Pfam: Fatty acid desaturase (PF03405.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;