Protein coding transcript 227462

• Transcript: Ll_transcript_99161
• CDS coordinates: 140-529 (+)
• Peptide sequence: MALRMNPLQTQTSIPQIVSLRSPKFLMASTLRTGSKEVENIKKPFSPPREVHVQVTHSMPPQKIEIFKSLEDWADKNILVHLKPVEKCWQPQDFLPDASADGFEEQVKELRERAKELPDGFEEQVKELRE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_99161

• Blastp: Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic from Soja with 84.43% of identity
• Blastx: Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic from Soja with 84.43% of identity
• Eggnog: Converts stearoyl-ACP to oleoyl-ACP by introduction of a cis double bond between carbons Delta(9) and Delta(10) of the acyl chain(ENOG410XPNS)
• Kegg: Link to kegg annotations (547808)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434321.1)
• Pfam: Fatty acid desaturase (PF03405.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;