Transcript | Ll_transcript_99166 |
---|---|
CDS coordinates | 140-808 (+) |
Peptide sequence | MALRMNPLQTQTSIPQIVSLRSPKFLMASTLRTGSKEVENIKKPFSPPREVHVQVTHSMPPQKIEIFKSLEDWADKNILVHLKPVEKCWQPQDFLPDASADGFEEQVKELRERAKELPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRDETGASLTSWAVWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGMVRSYTSLSYLGLYLLSSY* |
ORF Type | complete |
Blastp | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic from Soja with 85.97% of identity |
---|---|
Blastx | Stearoyl-[acyl-carrier-protein] 9-desaturase, chloroplastic from Soja with 90.73% of identity |
Eggnog | Converts stearoyl-ACP to oleoyl-ACP by introduction of a cis double bond between carbons Delta(9) and Delta(10) of the acyl chain(ENOG410XPNS) |
Kegg | Link to kegg annotations (547808) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434321.1) |
Pfam | Fatty acid desaturase (PF03405.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer