Transcript | Ll_transcript_322919 |
---|---|
CDS coordinates | 2-304 (+) |
Peptide sequence | AVSSLWKICEFHRENINGPVVIPSLLKFLPLRNDLDAARNVHARLLKMLTRNEADILGPNEENLPKVISIFSTILLRCDELATKETLSEINVFLDKHGDE* |
ORF Type | 5prime_partial |
Blastp | Importin-5 from Mus with 35.21% of identity |
---|---|
Blastx | Importin-5 from Mus with 35.21% of identity |
Eggnog | Importin(ENOG410XQAJ) |
Kegg | Link to kegg annotations (70572) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438860.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer