Transcript | Ll_transcript_100830 |
---|---|
CDS coordinates | 114-1019 (+) |
Peptide sequence | MMAAETLPHENGVFSNGDLGAKSNSSTTAKKSRESDRRRRRRKQKKNKQASQEPHPNSAEDGDDTKENTGLHQVVEQVEIKYVPEKAELDGGLDEEFRKIFEKFSFTDVTGSEDNDKKDESAENATAASKKADSDSEEEENDNEKKEKGGVSNKKKKLQRRMKIAELKQICSRPDVVEVWDATAADPKLLVFLKSYRNTVPVPRHWSQKRKFLQGKRGIEKQPFQLPDFIAATGIEKIRQAYIEKEDSKKLKQKQRERMQPKMGKMDIDYQVLHDAFFKYQTKPKLTSLGELYHEGKEFEV* |
ORF Type | complete |
Blastp | Splicing factor 3B subunit 2 from Homo with 51.75% of identity |
---|---|
Blastx | Splicing factor 3B subunit 2 from Homo with 50.97% of identity |
Eggnog | Splicing factor 3b subunit(COG5182) |
Kegg | Link to kegg annotations (10992) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433423.1) |
Pfam | Domain of unknown function (DUF382) (PF04037.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer