| Transcript | Ll_transcript_322920 |
|---|---|
| CDS coordinates | 1-336 (+) |
| Peptide sequence | VITMHVFYILQCVLLCHYLVFLILNYNAVQEVIRTWLNFLPLRNDLSLAKNVHGQLCKMLKRKDTNILGPNEENLPKVISIFSTILLRCDELATKETLSEINVFLDKHGDE* |
| ORF Type | 5prime_partial |
| Blastp | Importin-5 from Mus with 40% of identity |
|---|---|
| Blastx | Importin-5 from Mus with 40% of identity |
| Eggnog | Importin(ENOG410XQAJ) |
| Kegg | Link to kegg annotations (70572) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019438860.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer