Protein coding transcript 227625

• Transcript: Ll_transcript_98738
• CDS coordinates: 910-1785 (+)
• Peptide sequence: MQEGYIVPRIKVEPLPRNKLLSPIIFHEGRLVQRPTPIVTLLTFLWMPIGIILSILRVYLNIPLPERLAWYNYKLLGIKVIRKGNPPPAPKKGKSGVLFVCNHRTVLDPVVTAVALGRKISCVTYSISKFSEIISPIKAVALTRERDKDAANIKRLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQSVFYGTSARGFKLLDPYFVFMNPMPTYEITFLNQLPSELTCKGGKSAIEVANYIQRVLSGTLGFECTNLTRKDKYAMIAGTDGIVPSKKEKA*
• ORF Type: complete

Annotations of Ll_transcript_98738

• Blastp: Glycerol-3-phosphate 2-O-acyltransferase 6 from Arabidopsis with 84.43% of identity
• Blastx: Glycerol-3-phosphate 2-O-acyltransferase 6 from Arabidopsis with 84.43% of identity
• Eggnog: glycerol-3-phosphate acyltransferase(ENOG4110PXU)
• Kegg: Link to kegg annotations (AT2G38110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434982.1)
• Pfam: Acyltransferase (PF01553.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;