Protein coding transcript 227684

• Transcript: Ll_transcript_100644
• CDS coordinates: 98-556 (+)
• Peptide sequence: MDATVGQTLYPLHRCKTIHLVRHAQGVHNVEGEKNHDAYKSYDFFDAHLTPLGWEQVGNLRNHVKASGLSRRVELVIVSPLLRTMQTAVGVFGGEAYKNGTNGRPLMMENVGQSNHPAVSNLNCPPFIAVELCREQTFVTRLLGNEEEEKEV*
• ORF Type: complete

Annotations of Ll_transcript_100644

• Blastp: Phosphoglycerate mutase-like protein from Arabidopsis with 71.54% of identity
• Blastx: Phosphoglycerate mutase-like protein 2 from Arabidopsis with 60.13% of identity
• Eggnog: Phosphoglycerate mutase(ENOG4111QJY)
• Kegg: Link to kegg annotations (AT2G17280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431406.1)
• Pfam: Histidine phosphatase superfamily (branch 1) (PF00300.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;