Protein coding transcript 227800

• Transcript: Ll_transcript_98362
• CDS coordinates: 347-952 (+)
• Peptide sequence: MGSTSQSQKKNLHSLLLTNLTIPSSSSSPSSSNNDLDFDFSHVFGPNPSPSPSNNVPTPHIIHNRSHSFVGPSPRLPTSLFPLPQLASDSEPEDEIQKHVFEEEKVVPTHEGKIGPLDFLILRMVGQGSFGKVFLVRRKKGDDCLEGDGVFAMKVMKKDTIIKKNHVDYMRAERDILTKVVHPFIVQLRYSFQVLFLFFGL*
• ORF Type: complete

Annotations of Ll_transcript_98362

• Blastp: Serine/threonine-protein kinase AtPK2/AtPK19 from Arabidopsis with 39.36% of identity
• Blastx: Serine/threonine-protein kinase AtPK2/AtPK19 from Arabidopsis with 82.68% of identity
• Eggnog: protein serine/threonine kinase activity(ENOG410XNPH)
• Kegg: Link to kegg annotations (AT3G08720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456426.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;