Protein coding transcript 22781

• Transcript: Ll_transcript_364710
• CDS coordinates: 117-1172 (+)
• Peptide sequence: MNGNKAMEDANVEVIECNEKMVYMWGYLPGASSEKIPILSPTQVTLSLPSDSWKDVCGGGCGFAMAISEKGKLITWGSADDEGQSYLASGKHGDIPGPVQLPTEASVVKAAAGWAHCASVTEEGEVYSWGWKECVPSGKVIIDFTTGGSLQKDVAGKQSSPVAEQGSPQSSNTSSGSDSHHDNKKVGADVVKRRKISFARPESDSPASGDEFFTMSPSLATLGHGVKITSVAAGGRHTLALSDVGQVWGWGYGGEGQLGLGSRVKMVSSPHLIPCIESAAGKDRSSTFQQESSVGAQVSKVPGSYVKEIACGGRHSAVVTDAGALLTFGWGLYGQVSFLLTNSFFIFFIFC*
• ORF Type: complete

Annotations of Ll_transcript_364710

• Blastp: Ultraviolet-B receptor UVR8 from Arabidopsis with 27.68% of identity
• Blastx: RCC1 and BTB domain-containing protein 1 from Mus with 51.72% of identity
• Eggnog: regulator of chromosome condensation(COG5184)
• Kegg: Link to kegg annotations (AT5G63860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460943.1)
• Pfam: Regulator of chromosome condensation (RCC1) repeat (PF13540.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;