Transcript | Ll_transcript_364718 |
---|---|
CDS coordinates | 117-878 (+) |
Peptide sequence | MNGNKAMEDANVEVIECNEKMVYMWGYLPGASSEKIPILSPTQVTLSLPSDSWKDVCGGGCGFAMAISEKGKLITWGSADDEGQSYLASGKHGDIPGPVQLPTEASVVKAAAGWAHCASVTEEGEVYSWGWKECVPSGKVIIDFTTGGSLQKDVAGKQSSPVAEQGSPQSSNTSSGSDSHHDNKKVGADVVKRRKISFARPESDSPASGDEFFTMSPSLATLGHGVKITSVAAGGRHTLALSGSMKYEDIEGF* |
ORF Type | complete |
Blastp | RCC1 and BTB domain-containing protein 2 from Mus with 30.77% of identity |
---|---|
Blastx | RCC1 and BTB domain-containing protein 1 from Mus with 51.72% of identity |
Eggnog | regulator of chromosome condensation(COG5184) |
Kegg | Link to kegg annotations (105670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460943.1) |
Pfam | Regulator of chromosome condensation (RCC1) repeat (PF13540.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer