Protein coding transcript 22784

• Transcript: Ll_transcript_364719
• CDS coordinates: 117-878 (+)
• Peptide sequence: MNGNKAMEDANVEVIECNEKMVYMWGYLPGASSEKIPILSPTQVTLSLPSDSWKDVCGGGCGFAMAISEKGKLITWGSADDEGQSYLASGKHGDIPGPVQLPTEASVVKAAAGWAHCASVTEEGEVYSWGWKECVPSGKVIIDFTTGGSLQKDVAGKQSSPVAEQGSPQSSNTSSGSDSHHDNKKVGADVVKRRKISFARPESDSPASGDEFFTMSPSLATLGHGVKITSVAAGGRHTLALSGSMKYEDIEGF*
• ORF Type: complete

Annotations of Ll_transcript_364719

• Blastp: RCC1 and BTB domain-containing protein 2 from Mus with 30.77% of identity
• Blastx: E3 ISG15--protein ligase HERC5 from Homo with 37.84% of identity
• Eggnog: regulator of chromosome condensation(COG5184)
• Kegg: Link to kegg annotations (105670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460943.1)
• Pfam: Regulator of chromosome condensation (RCC1) repeat (PF13540.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;