Protein coding transcript 22787

• Transcript: Ll_transcript_364701
• CDS coordinates: 117-1103 (+)
• Peptide sequence: MNGNKAMEDANVEVIECNEKMVYMWGYLPGASSEKIPILSPTQVTLSLPSDSWKDVCGGGCGFAMAISEKGKLITWGSADDEGQSYLASGKHGDIPGPVQLPTEASVVKAAAGWAHCASVTEEGEVYSWGWKECVPSGKVIIDFTTGGSLQKDVAGKQSSPVAEQGSPQSSNTSSGSDSHHDNKKVGADVVKRRKISFARPESDSPASGDEFFTMSPSLATLGHGVKITSVAAGGRHTLALSDVGQVWGWGYGGEGQLGLGSRVKMVSSPHLIPCIESAAGKDRSSTFQQESSVGAQVSKVPGSYVKEIACGGRHSAVVTGQHFTFVL*
• ORF Type: complete

Annotations of Ll_transcript_364701

• Blastp: Probable E3 ubiquitin-protein ligase HERC3 from Homo with 26.21% of identity
• Blastx: RCC1 and BTB domain-containing protein 1 from Mus with 51.72% of identity
• Eggnog: ubiquitin protein ligase(COG5021)
• Kegg: Link to kegg annotations (8916)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460943.1)
• Pfam: Regulator of chromosome condensation (RCC1) repeat (PF13540.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;