Transcript | Ll_transcript_364701 |
---|---|
CDS coordinates | 117-1103 (+) |
Peptide sequence | MNGNKAMEDANVEVIECNEKMVYMWGYLPGASSEKIPILSPTQVTLSLPSDSWKDVCGGGCGFAMAISEKGKLITWGSADDEGQSYLASGKHGDIPGPVQLPTEASVVKAAAGWAHCASVTEEGEVYSWGWKECVPSGKVIIDFTTGGSLQKDVAGKQSSPVAEQGSPQSSNTSSGSDSHHDNKKVGADVVKRRKISFARPESDSPASGDEFFTMSPSLATLGHGVKITSVAAGGRHTLALSDVGQVWGWGYGGEGQLGLGSRVKMVSSPHLIPCIESAAGKDRSSTFQQESSVGAQVSKVPGSYVKEIACGGRHSAVVTGQHFTFVL* |
ORF Type | complete |
Blastp | Probable E3 ubiquitin-protein ligase HERC3 from Homo with 26.21% of identity |
---|---|
Blastx | RCC1 and BTB domain-containing protein 1 from Mus with 51.72% of identity |
Eggnog | ubiquitin protein ligase(COG5021) |
Kegg | Link to kegg annotations (8916) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460943.1) |
Pfam | Regulator of chromosome condensation (RCC1) repeat (PF13540.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer