Protein coding transcript 22798

• Transcript: Ll_transcript_366571
• CDS coordinates: 2-496 (+)
• Peptide sequence: FQLSKTNVNVNVSSSSSSSSPSLQPWSLASSSSPSFKLRPWTSLNRFQTKATSVPESAGDAASDSGALFRTLELGALFGMWFIFNIYFNIYNKQVLKVYPFPLTITAVQFAIGTVIVSLMWGLNLYKRPKISNAQLAAILPLAMVHTLGNLFTNMSLGKVAVSFT
• ORF Type: internal

Annotations of Ll_transcript_366571

• Blastp: Phosphoenolpyruvate/phosphate translocator 1, chloroplastic from Arabidopsis with 61.63% of identity
• Blastx: Phosphoenolpyruvate/phosphate translocator 1, chloroplastic from Arabidopsis with 70.25% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: Link to kegg annotations (AT5G33320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457000.1)
• Pfam: Triose-phosphate Transporter family (PF03151.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;