Protein coding transcript 228027

• Transcript: Ll_transcript_98911
• CDS coordinates: 523-1170 (+)
• Peptide sequence: MSSSVVTGMEPLTSGASNRIIPILKTLKLSLFFIYTFFLSFLLFVLPRRRRLSSPVPVLPPSSPSKNMKRRWLVREEEDTLRRRALAEYVGMGRDDGWFRWNTFIFYGIRNNALFCRSWFPVTGKLEGILIIIHGLNEHSGRYAEFARKLTSCHFGVYAMDWIGHGGSDGLHGYVPSLDHVVADTVSIILVLSSVFIDIALLYIFLFVIVGLRME*
• ORF Type: complete

Annotations of Ll_transcript_98911

• Blastp: Monoglyceride lipase from Homo with 49.12% of identity
• Blastx: Monoglyceride lipase from Homo with 49.12% of identity
• Eggnog: alpha beta hydrolase fold(COG2267)
• Kegg: Link to kegg annotations (11343)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415146.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;