Transcript | Ll_transcript_98913 |
---|---|
CDS coordinates | 242-649 (+) |
Peptide sequence | MHTAINNWINLRLNMIISFVSFSYYFLMDWSYLFSCQTGHGGSDGLHGYVPSLDYVVADTGAFLEKVRSENPGIPCFLFGHSTGGAVVLKAASLPHIEVMVEGIILTSPALRVKPAHPIVGVSFALVGCVCYVCN* |
ORF Type | complete |
Blastp | Uncharacterized abhydrolase domain-containing protein DDB_G0269086 from Dictyostelium with 33.33% of identity |
---|---|
Blastx | - |
Eggnog | alpha beta hydrolase fold(COG2267) |
Kegg | Link to kegg annotations (DDB_G0269086) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417940.1) |
Pfam | Alpha/beta hydrolase family (PF12697.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer