Protein coding transcript 228073

• Transcript: Ll_transcript_99820
• CDS coordinates: 526-1182 (+)
• Peptide sequence: MQICPLLYNLFQRVILRVKDDSEGGSLSFPYHTEIPRILLFGFLGFTCSILAPLMLPFLLFYFFLAYLVYRNQIINVYITKYDSGGQYWPIAHNTTVFSLIVAQVIALGVFGLKHSSVASGFTIPLLICTLLFHQYCRQRFLPIFKSNSAQILIDMDLRDEHSGSMGEIYEHLSSAYSQSSLVPDASNHTKCFSNREDKRSDQSSEDIEKGKEVIQKE*
• ORF Type: complete

Annotations of Ll_transcript_99820

• Blastp: CSC1-like protein At1g10090 from Arabidopsis with 58.26% of identity
• Blastx: CSC1-like protein At1g10090 from Arabidopsis with 58.58% of identity
• Eggnog: transmembrane protein 63C(COG5594)
• Kegg: Link to kegg annotations (AT1G10090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436991.1)
• Pfam: Calcium-dependent channel, 7TM region, putative phosphate (PF02714.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;