Protein coding transcript 228091

• Transcript: Ll_transcript_98693
• CDS coordinates: 199-519 (+)
• Peptide sequence: MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEEEGDLSV*
• ORF Type: complete

Annotations of Ll_transcript_98693

• Blastp: 60S ribosomal protein L23 from Nicotiana with 91.51% of identity
• Blastx: 60S ribosomal protein L23 from Arabidopsis with 92.45% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002435)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_007162592.1)
• Pfam: Ribosomal protein L14p/L23e (PF00238.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;