Transcript | Ll_transcript_99043 |
---|---|
CDS coordinates | 2463-3143 (+) |
Peptide sequence | MSGNGAMQFDAEYARWQEEQNRQINELRAAVNSHASDTELRMIIDGILAHYDEIFRLKGIAAKADVFHLLSGMWKTPAERCFLWLGGFRSSEVLKLLVNQLEPLTEQQVAGITNLQQSSQQAEDALSQGMDALQQSLAETLSTGSQNSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWLARPRD* |
ORF Type | complete |
Blastp | Transcription factor TGA2.2 from Oryza sativa with 85.4% of identity |
---|---|
Blastx | Transcription factor TGA2.2 from Oryza sativa with 83.53% of identity |
Eggnog | Transcription factor(ENOG410YSUA) |
Kegg | Link to kegg annotations (4332660) |
CantataDB | Link to cantataDB annotations (CNT0000028) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413258.1) |
Pfam | Seed dormancy control (PF14144.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer