Protein coding transcript 228166

• Transcript: Ll_transcript_99057
• CDS coordinates: 258-761 (+)
• Peptide sequence: MGLRNPGLFRSFIKEGWEKATFVAKFFCFLHVTDTYLVSPVQTFGPSMLPAIDLTANVFLIERISARSGKAACGDIVVLRSPQNPRKFITKRLVGIEGDTVTYVSSPDNSDKCETVVVPKGHVWVQGDNIYKSTDSRNFGPVPYGLIQGRIFWRVSPLKDFGPFWKN*
• ORF Type: complete

Annotations of Ll_transcript_99057

• Blastp: Mitochondrial inner membrane protease subunit 1 from Mus with 38.71% of identity
• Blastx: Mitochondrial inner membrane protease subunit 1 from Mus with 38.71% of identity
• Eggnog: Signal peptidase i(COG0681)
• Kegg: Link to kegg annotations (66541)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413263.1)
• Pfam: Peptidase S24-like (PF00717.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;