Protein coding transcript 228264

• Transcript: Ll_transcript_100541
• CDS coordinates: 111-944 (+)
• Peptide sequence: MVVLFLRSLSFFSCLLVIIILLSKTSAQPIDARYFCNKDNDRGNYTTNSTYDTNLKTLLSTLTSISESNNFGFYNLSYGENTDKVYATALCRGDIKTDKCNTCLNNARINLTLVCENRKEAIGWYEDETCMLRYSDRLILGVMEIGPAYYAWNEHNATSADEFNEDVRSLMERVTSKAALGNSSLKYATGSMVGPNDQTIYCLVQCTPDLSGSQCSGCLNETISQIPGCCNNRLGARQARPSCLLRYETNFLFYDPEADAPSPPPPTTSGTSFILLN*
• ORF Type: complete

Annotations of Ll_transcript_100541

• Blastp: Cysteine-rich receptor-like protein kinase 26 from Arabidopsis with 38.71% of identity
• Blastx: Cysteine-rich receptor-like protein kinase 26 from Arabidopsis with 38.46% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G38830)
• CantataDB: Link to cantataDB annotations (CNT0002983)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427078.1)
• Pfam: Salt stress response/antifungal (PF01657.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;