Transcript | Ll_transcript_100541 |
---|---|
CDS coordinates | 111-944 (+) |
Peptide sequence | MVVLFLRSLSFFSCLLVIIILLSKTSAQPIDARYFCNKDNDRGNYTTNSTYDTNLKTLLSTLTSISESNNFGFYNLSYGENTDKVYATALCRGDIKTDKCNTCLNNARINLTLVCENRKEAIGWYEDETCMLRYSDRLILGVMEIGPAYYAWNEHNATSADEFNEDVRSLMERVTSKAALGNSSLKYATGSMVGPNDQTIYCLVQCTPDLSGSQCSGCLNETISQIPGCCNNRLGARQARPSCLLRYETNFLFYDPEADAPSPPPPTTSGTSFILLN* |
ORF Type | complete |
Blastp | Cysteine-rich receptor-like protein kinase 26 from Arabidopsis with 38.71% of identity |
---|---|
Blastx | Cysteine-rich receptor-like protein kinase 26 from Arabidopsis with 38.46% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G38830) |
CantataDB | Link to cantataDB annotations (CNT0002983) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427078.1) |
Pfam | Salt stress response/antifungal (PF01657.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer