Protein coding transcript 228286

• Transcript: Ll_transcript_99631
• CDS coordinates: 3-686 (+)
• Peptide sequence: VVYLSLSRYVTLFSYLFKKERVSYSLYTFRNEDLGFSIFREIERNRTMTDHHEHGELKGEPLLEKISGKIHDHDSSSSSDSDNEKKTSSSSSSSIKSKVFRLFGREKPVHHVLGGGKSADVFLWRNKKISVAVLGVATAIWVLFELLEYHLLTLVCHLLIFALAVLFLWSNASAFINKSTPKIPQVHIPEEPVLQFASALRLEINRVFSVLREIALGRELKKFLSVC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_99631

• Blastp: Reticulon-like protein B5 from Arabidopsis with 66.67% of identity
• Blastx: Reticulon-like protein B1 from Arabidopsis with 75.4% of identity
• Eggnog: Reticulon(ENOG410XPKH)
• Kegg: Link to kegg annotations (AT2G46170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424526.1)
• Pfam: Reticulon (PF02453.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;