Transcript | Ll_transcript_99638 |
---|---|
CDS coordinates | 3-392 (+) |
Peptide sequence | VVYLSLSRYVTLFSYLFKKERVSYSLYTFRNEDLGFSIFREIERNRTMTDHHEHGELKGEPLLEKISGKIHDHDSSSSSDSDNEKKTSSSSSSSIKSKVFRLFGREKPVHHVLGGGKCIQFPFYVLLVI* |
ORF Type | 5prime_partial |
Blastp | Reticulon-like protein B5 from Arabidopsis with 65.52% of identity |
---|---|
Blastx | Reticulon-like protein B1 from Arabidopsis with 68.78% of identity |
Eggnog | Reticulon(ENOG410XPKH) |
Kegg | Link to kegg annotations (AT2G46170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424526.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer