| Transcript | Ll_transcript_99638 |
|---|---|
| CDS coordinates | 3-392 (+) |
| Peptide sequence | VVYLSLSRYVTLFSYLFKKERVSYSLYTFRNEDLGFSIFREIERNRTMTDHHEHGELKGEPLLEKISGKIHDHDSSSSSDSDNEKKTSSSSSSSIKSKVFRLFGREKPVHHVLGGGKCIQFPFYVLLVI* |
| ORF Type | 5prime_partial |
| Blastp | Reticulon-like protein B5 from Arabidopsis with 65.52% of identity |
|---|---|
| Blastx | Reticulon-like protein B1 from Arabidopsis with 68.78% of identity |
| Eggnog | Reticulon(ENOG410XPKH) |
| Kegg | Link to kegg annotations (AT2G46170) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019424526.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer