Protein coding transcript 228288

• Transcript: Ll_transcript_99640
• CDS coordinates: 276-1001 (+)
• Peptide sequence: MADHHEHEEVKGESLLEKISGKIHDHDSSSSIKSKVFRIFGREKPVHHVLGGGKPADVLLWRNKKISATVLGVVTAIWVLFELLEYGFLTLVCHLLIIALAVLFLWSNASAFINKSTPKIPQVHIPEEPVLQFASALRLEINRAFAVLRDIASGRDLKKFLSVIAGLWVFSILGSYANFLTLFYIAFVLLHTLPVLYEKYEDQVDSFAEKATAEIKKQYAVFDAKVLSKIPRGPSKDKKKD*
• ORF Type: complete

Annotations of Ll_transcript_99640

• Blastp: Reticulon-like protein B2 from Arabidopsis with 61.62% of identity
• Blastx: Reticulon-like protein B2 from Arabidopsis with 61.25% of identity
• Eggnog: Reticulon(ENOG410XPKH)
• Kegg: Link to kegg annotations (AT4G11220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422265.1)
• Pfam: Reticulon (PF02453.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;