Protein coding transcript 228289

• Transcript: Ll_transcript_99641
• CDS coordinates: 3-917 (+)
• Peptide sequence: VVYLSLSRYVTLFSYLFKKERVSYSLYTFRNEDLGFSIFREIERNRTMTDHHEHGELKGEPLLEKISGKIHDHDSSSSSDSDNEKKTSSSSSSSIKSKVFRLFGREKPVHHVLGGGKSADVFLWRNKKISVAVLGVATAIWVLFELLEYHLLTLVCHLLIFALAVLFLWSNASAFINKSTPKIPQVHIPEEPVLQFASALRLEINRVFSVLREIALGRELKKFLSVIAGLWVFSILGSYANFLTLFYIAFVLLHTVPVLYEKYEDQVDSFAEKATIVIKKQYAEFDAKVLSKIPIGPSKDKKKD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_99641

• Blastp: Reticulon-like protein B2 from Arabidopsis with 65.31% of identity
• Blastx: Reticulon-like protein B1 from Arabidopsis with 72.86% of identity
• Eggnog: Reticulon(ENOG410XPKH)
• Kegg: Link to kegg annotations (AT4G11220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424526.1)
• Pfam: Reticulon (PF02453.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;