Transcript | Ll_transcript_324649 |
---|---|
CDS coordinates | 388-777 (+) |
Peptide sequence | MQRAKKQLSSIVTCFERCFTWPPEGSWIGFGWFVATASVDMYAKFDKIREASFVFNTVLDKDVVLCTALIVGYAQHCLDGAALEVYRGIKPNEYTCASILINCGNLGDLVNDHLIHGLKSNGVTFISIIL |
ORF Type | 3prime_partial |
Blastp | Pentatricopeptide repeat-containing protein At5g65570 from Arabidopsis with 54.95% of identity |
---|---|
Blastx | Pentatricopeptide repeat-containing protein At5g65570 from Arabidopsis with 54.95% of identity |
Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
Kegg | Link to kegg annotations (AT5G65570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445374.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer