Protein coding transcript 228382

• Transcript: Ll_transcript_99464
• CDS coordinates: 138-596 (+)
• Peptide sequence: MCLIIKGIRFLQVELVNGDLVLNRGNPEWWSFYDTDTSDAHGCGEFPGPMAIIVSEETPQGIIGETLSKFSIWGLYITFVLAVGRFIRLQCSDLRMRIPYENLPSCDRLMAICEDIYAARAEGELEVEEVLFWTLVKIYRSPHMLLEYTQPD*
• ORF Type: complete

Annotations of Ll_transcript_99464

• Blastp: Piezo-type mechanosensitive ion channel homolog from Arabidopsis with 72.92% of identity
• Blastx: Piezo-type mechanosensitive ion channel homolog from Arabidopsis with 72.92% of identity
• Eggnog: Piezo-type mechanosensitive ion channel component(ENOG410YVF6)
• Kegg: Link to kegg annotations (AT2G48060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423186.1)
• Pfam: Piezo non-specific cation channel, R-Ras-binding domain (PF12166.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;