Transcript | Ll_transcript_99464 |
---|---|
CDS coordinates | 138-596 (+) |
Peptide sequence | MCLIIKGIRFLQVELVNGDLVLNRGNPEWWSFYDTDTSDAHGCGEFPGPMAIIVSEETPQGIIGETLSKFSIWGLYITFVLAVGRFIRLQCSDLRMRIPYENLPSCDRLMAICEDIYAARAEGELEVEEVLFWTLVKIYRSPHMLLEYTQPD* |
ORF Type | complete |
Blastp | Piezo-type mechanosensitive ion channel homolog from Arabidopsis with 72.92% of identity |
---|---|
Blastx | Piezo-type mechanosensitive ion channel homolog from Arabidopsis with 72.92% of identity |
Eggnog | Piezo-type mechanosensitive ion channel component(ENOG410YVF6) |
Kegg | Link to kegg annotations (AT2G48060) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423186.1) |
Pfam | Piezo non-specific cation channel, R-Ras-binding domain (PF12166.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer