Protein coding transcript 228488

• Transcript: Ll_transcript_53290
• CDS coordinates: 141-1250 (+)
• Peptide sequence: MWFQMSNFKLVYLLFLGFLFLNCFQVFESNAQRIPQEEVNVLQAISDKLENLSWKVTQRSCIEDQGFNQKLNNGDTVRNITCDCTFQSSTVCHVTSILLKGLNISGVMPSEFGNLTHLTVLDLTRNYLNGSFPKSFGQTSLITLSLLGNRLSGAIPSEVGEIANLEELTLEDNLLGGPLPPSLGNLSNLKRLLLSANNFTGSIPETLSKLKNLTDFRIDGSSLSGKIPDFIGNWTKLDRLDLQGTSMEGPIPSTISKLTILTQLRITDLNGSTMTFPELENLKNLNRLELRNCLITGPIPDYIGEMTNLKTLDLSFNMLTGSIPDSIQGLDALDFMFLTNNSLSGPIQDWILNWKEKMLAYFLDFVFSN*
• ORF Type: complete

Annotations of Ll_transcript_53290

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At1g53430 from Arabidopsis with 58.29% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At1g53430 from Arabidopsis with 59.82% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G53430)
• CantataDB: Link to cantataDB annotations (CNT0000418)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449219.1)
• Pfam: Leucine Rich Repeat (PF00560.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;