Protein coding transcript 228490

• Transcript: Ll_transcript_53267
• CDS coordinates: 612-1151 (+)
• Peptide sequence: MLKGNYKVKLHFAEIMFSDDHTYSSLGRRIFDVSIQGIKYLKDFNIMEAVGGVGKGITKEFDVDVNDSTLEIHLYWAGKGTTAIPNRGVYGPLISAITVTPNFKIKSGGLSAGAIAGIVAALCVFIILVLVVLRKMGFLGRKDKTDKELLDLKTGYFSLRQIKAATNNFDQANKIGEGGF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_53267

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At1g53440 from Arabidopsis with 63.98% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At1g53440 from Arabidopsis with 53.95% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G53440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453518.1)
• Pfam: Di-glucose binding within endoplasmic reticulum (PF11721.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;